PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1707s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 327aa    MW: 37016.4 Da    PI: 4.8542
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1707s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.33.6e-27958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krien++nrqvtfskRrng++KKA+ELSvLCd+++a+i+fs++++l  +s
  Cagra.1707s0007.1.p  9 KRIENTTNRQVTFSKRRNGLIKKAYELSVLCDIDIALIMFSPSDRLSLFS 58
                         79******************************************998776 PP

2K-box14.21.8e-06110177976
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleq 76 
                          + +++ e+l++e+ +L++++++ ++e++++  + +   s+++ +  e+qL + l+++ +++++ll ++
  Cagra.1707s0007.1.p 110 TINSDVEELEREVCRLQQQLQMAEEELKRYEPDPVRFTSMEDYEVCEKQLLDTLSHVLQRRDHLLSSH 177
                          5678899********************************************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.156161IPR002100Transcription factor, MADS-box
CDDcd002656.69E-34275No hitNo description
SuperFamilySSF554554.97E-29282IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRVKLEIKR IENTTNRQVT FSKRRNGLIK KAYELSVLCD IDIALIMFSP SDRLSLFSGK  60
TRIEDVFTRF INLPKQERER DIQSKECLLR ILQQLKTEND IALQHTNPTT INSDVEELER  120
EVCRLQQQLQ MAEEELKRYE PDPVRFTSME DYEVCEKQLL DTLSHVLQRR DHLLSSHHLS  180
SYDAASTMQQ SIAGPFVNDV VEGWLPESAH NQSHLFDASA HSNQLRELSS AMYEPLLQGS  240
SSSSNQNNMS ECHVTSHNGE MFPEWAQAYS SSALFASMQQ QHGGVVPSIE EMMPAQQGDI  300
PAVTTAAQAD PEISDYETKV PQLSSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A6e-16270168Myocyte-specific enhancer factor 2A
3mu6_B6e-16270168Myocyte-specific enhancer factor 2A
3mu6_C6e-16270168Myocyte-specific enhancer factor 2A
3mu6_D6e-16270168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0564570.0DQ056457.1 Arabidopsis thaliana MADS-box family protein (At1g22130) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303516.10.0hypothetical protein CARUB_v10010907mg
SwissprotQ9LM460.0AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLR0I2E60.0R0I2E6_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0001_23200.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21792365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.10.0AGAMOUS-like 104